The domain within your query sequence starts at position 61 and ends at position 349; the E-value for the 7TM_GPCR_Srsx domain shown below is 3.3e-7.

MLVCGIGNFVFIAALARYKKLRNLTNLLIANLAISDFLVAIVCCPFEMDYYVVRQLSWAH
GHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMVSIL
IAVPSAYFTTETILVIVKNQEKIFCGQIWSVDQQLYYKSYFLFVFGLEFVGPVVTMTLCY
ARISQELWFKAVPGFQTEQIRKRLRCRRKTVLLLMGILTAYVLCWAPFYGFTIVRDFFPT
VVVKEKHYLTAFYVVECIAMSNSMINTICFVTVKNNTMKYFKKMLRLHW

7TM_GPCR_Srsx

7TM_GPCR_Srsx
PFAM accession number:PF10320
Interpro abstract (IPR019424):

Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [(PUBMED:7585938)]. Srsx is a solo family amongst the superfamilies of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' [(PUBMED:18050473)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 7TM_GPCR_Srsx