The domain within your query sequence starts at position 82 and ends at position 364; the E-value for the 7TM_GPCR_Srw domain shown below is 1.2e-10.

VVYIIVFVIGLPSNGMALWIFLFRTKKKHPAVIYMANLALADLLSVIWFPLKISYHLHGN
NWVYGEALCKVLIGFFYGNMYCSILFMTCLSVQRYWVIVNPMGHPRKKANIAVGVSLAIW
LLIFLVTIPLYVMKQTIYIPALNITTCHDVLPEEVLVGDMFNYFLSLAIGVFLFPALLTA
SAYVLMIKTLRSSAMDEHSEKKRQRAIRLIITVLAMYFICFAPSNLLLVVHYFLIKTQRQ
SHVYALYLVALCLSTLNSCIDPFVYYFVSKDFRDHARNALLCR

7TM_GPCR_Srw

7TM_GPCR_Srw
PFAM accession number:PF10324
Interpro abstract (IPR019427): This entry represents serpentine receptor class w (Srw), which is a solo family amongst the superfamilies of chemoreceptors. The genes encoding Srw do not appear to be under as strong an adaptive evolutionary pressure as those of Srz [(PUBMED:15761060)].
GO function:G-protein coupled peptide receptor activity (GO:0008528)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 7TM_GPCR_Srw