The domain within your query sequence starts at position 595 and ends at position 829; the E-value for the 7tm_3 domain shown below is 6.4e-55.

TAITILVLVTFVKYKDTPIVKANNCILSYILLISLVFCFLCSLLFIGHPNQVTCILQQTT
FGLFFTVAVSTVLAKTITVVMAFKLTTPGKRMRGMMTGAPKLVIPICTLIQLVLCGIWLL
TSPPFIERDIQSEHGKTVIFCNKGSVLSFHVVLGYLGSLALGSFIVAFLARNLPDRFNEA
KFLTFSMLVFCSVWITFLPVYHSTRGKVMVVVEVFSILASSAGLLGCIFVPKCYV

7tm_3

7tm_3
PFAM accession number:PF00003
Interpro abstract (IPR017978):

G protein-coupled receptors (GPCRs) constitute a vast protein family that encompasses a wide range of functions, including various autocrine, paracrine and endocrine processes. They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups [(PUBMED:12679517)]. The term clan can be used to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence [(PUBMED:8170923)]. The currently known clan members include rhodopsin-like GPCRs (Class A, GPCRA), secretin-like GPCRs (Class B, GPCRB), metabotropic glutamate receptor family (Class C, GPCRC), fungal mating pheromone receptors (Class D, GPCRD), cAMP receptors (Class E, GPCRE) and frizzled/smoothened (Class F, GPCRF) [(PUBMED:8170923), (PUBMED:8081729), (PUBMED:15914470), (PUBMED:18948278), (PUBMED:16753280)]. GPCRs are major drug targets, and are consequently the subject of considerable research interest. It has been reported that the repertoire of GPCRs for endogenous ligands consists of approximately 400 receptors in humans and mice [(PUBMED:12679517)]. Most GPCRs are identified on the basis of their DNA sequences, rather than the ligand they bind, those that are unmatched to known natural ligands are designated by as orphan GPCRs, or unclassified GPCRs [(PUBMED:23020293)].

GPCR family 3 receptors (also known as family C) are structurally similar to other GPCRs, but do not show any significant sequence similarity and thus represent a distinct group. Structurally they are composed of four elements; an N-terminal signal sequence; a large hydrophilic extracellular agonist-binding region containing several conserved cysteine residues which could be involved in disulphide bonds; a shorter region containing seven transmembrane domains; and a C-terminal cytoplasmic domain of variable length [(PUBMED:17266540)]. Family 3 members include the metabotropic glutamate receptors, the extracellular calcium-sensing receptors, the gamma-amino-butyric acid (GABA) type B receptors, and the vomeronasal type-2 receptors [(PUBMED:1309649), (PUBMED:8255296), (PUBMED:10773016), (PUBMED:9292726)]. As these receptors regulate many important physiological processes they are potentially promising targets for drug development.

This entry represents the C-terminal region of family 3 GPCR receptor proteins, which contains the seven transmembrane region. The seven TM regions assemble in such a way as to produce a docking pocket into which such molecules as cyclamate and lactisole have been found to bind and consequently confer the taste of sweetness [(PUBMED:16076846)].

GO process:G-protein coupled receptor signaling pathway (GO:0007186)
GO component:integral component of membrane (GO:0016021)
GO function:G-protein coupled receptor activity (GO:0004930)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 7tm_3