The domain within your query sequence starts at position 29 and ends at position 306; the E-value for the 7tm_4 domain shown below is 1.3e-51.

FLLIYIITLVGNLGIILLILLDSRLHTPMYIFLSNLSLVDFCYSSTITPKVMAGFLTGDR
IISYNACASQMFFFAHFADVESYLLVSMAYDHYVAVCKPLHYATTMTTHLCVFLVIGCYI
CGFLNASIYTVDVFSLSFCESNVIHHFFCDVLAVMIISRSDKYINELVLISVASFNIIFS
LILILISYMFIFTNILKINSSEGYRKALSTCTSHFTAVFIYYGTVIFMYLQPTSSHSMDT
DKIVSVFYSIVIPMLNPLVYSMRNKEVKNAFTKVVLRS

7tm_4

7tm_4
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 7tm_4