The domain within your query sequence starts at position 1 and ends at position 68; the E-value for the AAA_11 domain shown below is 5.8e-26.

XCCTLSTSGGLLLESAFRGQGGVPFSCVIVDEAGQSCEVETLSPLIHRCNKLILVGDPKQ
LPPTVISM

AAA_11

AAA_11
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AAA_11