The domain within your query sequence starts at position 68 and ends at position 152; the E-value for the AAA_11 domain shown below is 2.1e-19.

STQSTFQMPQKEDILKHRVVVVTLSTSQYLCQLDLEPGFFTHVLLDEAAQAMECETIMPL
ALATKNTRIVLAGDHMQLSPFVYSE

AAA_11

AAA_11
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AAA_11