The domain within your query sequence starts at position 180 and ends at position 364; the E-value for the AAA_12 domain shown below is 7.4e-42.

LEVSLFERLVKVNIPFVRLNYQHRMRPEIARLLTPHIYQDLENHPSVLKYEQIKGVSSNL
FFVEHNFPEQEIQEGKSHQNQHEAHFVVELCQYLLCQEYLPSQITILTTYTGQLFCLRKL
MPVKTFAGIKVHVVDKYQGEENDIILLSLVRSNQEGKVGFLQIPNRICVALSRAKKGMYC
IGNMQ

AAA_12

AAA_12
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AAA_12