The domain within your query sequence starts at position 840 and ends at position 1052; the E-value for the AAA_12 domain shown below is 3.4e-36.
LHVSLLDRLYEHYPAEFPCRILLCENYRSHEAIINYTSELFYEGKLMASGKQPAHKDFYP LTFFTARGEDVQEKNSTAFYNNAEVFEVVERVEELRRKWPVAWGKLDDGSIGVVTPYADQ VFRIRAELRKKRLSDVNVERVLNVQGKQFRVLFLSTVRTRHTCKHKQTPIKKKEQLLEDS TEDLDYGFLSNYKLLNTAITRAQSLVAVVGDPV
AAA_12 |
---|
PFAM accession number: | PF13087 |
---|---|
Interpro abstract (IPR041679): | This domain contains a P-loop motif that is characteristic of the AAA superfamily. Proteins containing this domain are DEAD-like helicases belonging to superfamily (SF)1, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. Similar to SF2 helicases, SF1 helicases do not form toroidal structures like SF3-6 helicases. Their helicase core consists of two similar protein domains that resemble the fold of the recombination protein RecA [ (PUBMED:10322435) (PUBMED:1552844) (PUBMED:16935882) ]. Proteins containing this domain include helicases, such as Dna2 an Nam7. Dna2 is a DNA replication factor with single-stranded DNA-dependent ATPase, ATP-dependent nuclease, (5'-flap endonuclease) and helicase activities [ (PUBMED:10880469) (PUBMED:22570407) ]. Nam7 (also known as Upf1) is an ATP-dependent RNA helicase involved in the nonsense-mediated mRNA decay (NMD) pathway [ (PUBMED:29236296) ]. This domain can also be found in some virus polyproteins. This domain is also known as HelicC. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AAA_12