The domain within your query sequence starts at position 841 and ends at position 1053; the E-value for the AAA_12 domain shown below is 7.4e-38.

LHVSLLDRLYEHYPAEFPCRILLCENYRSHEAIINYTSELFYEGKLMASGKQPAHKDFYP
LTFFTARGEDVQEKNSTAFYNNAEVFEVVERVEELRRKWPVAWGKLDDGSIGVVTPYADQ
VFRIRAELRKKRLSDVNVERVLNVQGKQFRVLFLSTVRTRHTCKHKQTPIKKKEQLLEDS
TEDLDYGFLSNYKLLNTAITRAQSLVAVVGDPV

AAA_12

AAA_12
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AAA_12