The domain within your query sequence starts at position 54 and ends at position 438; the E-value for the AAA_15 domain shown below is 3.1e-9.

IESIQLRNFMCHSMLGPFKFGSNVNFVVGNNGSGKSAVLTALIVGLGGKAVATNRGSSLK
GFVKAGQNSADISITLRNRGDDAFRANVYGDSIVVQQHISVDGSRSYKLKSEKGTVVSTR
KEELIAILDHFNIQVDNPVSVLTQEMSKQFLQSKNEGDKYKFFMKATQLEQMKEDYSYIM
ETKERTKEQINQGEERLTELKRQCLEKEERFQNIAGLSTMKTNLEYLKHEMAWAVVNEIE
KQLNAIRDNIKIGEERAAKLDRKMEEQQVRLNDAEKKYKDIQDKLEKISEETNARAPECM
ALKTDVIARTRAFNDAEVLYNRSLNEYKALKKDGEQLCKRIEELKKSTDQSLEPERLERQ
KRICWLKEKVKALQDQEHTVNQEAE

AAA_15

AAA_15
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AAA_15