The domain within your query sequence starts at position 34 and ends at position 138; the E-value for the AAA_16 domain shown below is 3.3e-14.

NLFGVQVQYKHLIELLKRTAIYGESNSVLIVGPRGSGKTTLLNHALKELMEIEVSENVIQ
VHLNGLLQTNEKIALKEITRQLNLDNVVEDKVFGMLVCLEVSKYR

AAA_16

AAA_16
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AAA_16