The domain within your query sequence starts at position 6 and ends at position 290; the E-value for the AAA_23 domain shown below is 2.7e-24.

KMSILGVRSFGIEDKDKQIISFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGNT
FVHDPKVAQETDVRAQIRLQFRDVNGEMVAVHRSMLCSQKNKKTEFKTLEGVITRMKHGE
KVSLSSKCAEIDREMISCLGVSKSVLNNVIFCHQEDSNWPLSEGKALKQKFDEIFSATRY
IKALDTLRQVRQTQGQKVKECQTELKYLKQNKEKACEIRDQITSKEAQLASSQEIVRSYE
DELEPLKNRLKEIEHNLSKIMKLDNEIKALESRKKQMEKDNSELE

AAA_23

AAA_23
PFAM accession number:PF13476
Interpro abstract (IPR038729): This entry represents the AAA domain found in some DNA repair proteins, such as Rad50, SbcC, RecF, and RecN.

AAA ATPases belong to the AAA+ superfamily of ringshaped P-loop NTPases, which exert their activity through the energy-dependent unfolding of macromolecules [(PUBMED:15037233)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AAA_23