The domain within your query sequence starts at position 218 and ends at position 523; the E-value for the AAA_34 domain shown below is 2.3e-141.

RHPDAVVETSSLSSVTPPDVWYKTSISEETIDNGWLSALQLEAVTYAAQQHETFLPNGDR
AGFLIGDGAGVGKGRTIAGIIYENYLLSRKRALWFSVSNDLKYDAERDLRDIGAKNILVH
SLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQSGGKYKTRLKQLLHWCGDDFDGVIV
FDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIW
GEGTPFREFSDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVLLSQSY
VKMYNK

AAA_34

AAA_34
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AAA_34