The domain within your query sequence starts at position 2829 and ends at position 3096; the E-value for the AAA_8 domain shown below is 2.5e-83.

YNEVNTKMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLARLAAFTAGCEVF
EILLSRGYSENNFRDDLKNLYMKLGLENKMMIFLFTDAHVAEEGFLELINNMLTSGMVPA
LFAEEEKDNILGQIGQEALKFGMGPAKESVWQFFVNKSANNLHIVLGMSPVGDTLRTRCR
NFPGLVNNTGIDWFMPWPPQALHAVAKSFLGDNSMIPDEKLEELVEHVVMVHQSVGEFSK
QFQQKLRRSNYVTPKNYLDFINTYSKLL

AAA_8

AAA_8
PFAM accession number:PF12780
Interpro abstract (IPR024317):

The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases. The core of the 380 kDa motor unit contains a concatenated chain of six AAA modules, of which four (D1 - D4) correspond to the ATP binding sites with P-loop signatures described previously, and two (D5, D6) are modules in which the P loop has been lost in evolution. This particular entry represents the D4 ATP-binding domain of the motor [(PUBMED:11250194)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AAA_8