SMART: Pfam domain AATF-Che1

The domain within your query sequence starts at position 187 and ends at position 339; the E-value for the AATF-Che1 domain shown below is 4.6e-40.

EVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPVFKDKGGPEFASALKNSH
KALKALLRSLVDLQEELLFQYPDTRHIVNGAKPNTESEEISSEDDELVGEKKKQRKAPPK
RKLEMEDYPSFMAKRFADFTIYRNHTLQKWHDK

AATF-Che1

PFAM accession number:	PF13339
Interpro abstract (IPR025160):	This leucine zipper-containing domain is found in apoptosis antagonizing transcription factor (AATF, also known as Che-1) and related proteins. AATF may function as a general inhibitor of the histone deacetylase HDAC1 [ (PUBMED:12450794) ]. AATF has been shown to inhibit the abberant production of the amyloid beta peptide 1-42 by direct interaction with Par4 [ (PUBMED:14627703) ]. This interaction occurs via the leucine zipper.

PFAM accession number:

PF13339

Interpro abstract (IPR025160):

This leucine zipper-containing domain is found in apoptosis antagonizing transcription factor (AATF, also known as Che-1) and related proteins. AATF may function as a general inhibitor of the histone deacetylase HDAC1 [ (PUBMED:12450794) ]. AATF has been shown to inhibit the abberant production of the amyloid beta peptide 1-42 by direct interaction with Par4 [ (PUBMED:14627703) ]. This interaction occurs via the leucine zipper.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AATF-Che1