The domain within your query sequence starts at position 551 and ends at position 601; the E-value for the AA_permease_C domain shown below is 1.2e-28.
FKVPFVPVLPVLSIFVNIYLMMQLDQGTWVRFAVWMLIGFTIYFGYGIWHS
AA_permease_C |
![]() |
---|
PFAM accession number: | PF13906 |
---|---|
Interpro abstract (IPR029485): | This entry represents the C-terminal of the cationic amino acid transporters (CATs) from bacteria, plants and animals. CATs are permeases involved in the transport of the cationic amino acids. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AA_permease_C