The domain within your query sequence starts at position 82 and ends at position 152; the E-value for the AA_permease_N domain shown below is 5.3e-22.

FHAYDSHTNTYYLQTMDAVPKIEYYRNTGSVSGPKVNRPSLLEIHEQLAKNVTVAPGSAD
RVANGDGMPGD

AA_permease_N

AA_permease_N
PFAM accession number:PF08403
Interpro abstract (IPR013612):

Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell. A number of such proteins have been found to be evolutionary related [(PUBMED:3146645), (PUBMED:2687114), (PUBMED:8382989)]. These proteins appear to contain up to 12 transmembrane segments. The best conserved region in this family is located in the second transmembrane segment. This domain is found to the N terminus of the amino acid permease domain (IPR004841) in metazoan Na-K-Cl cotransporters.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AA_permease_N