The domain within your query sequence starts at position 276 and ends at position 446; the E-value for the ABA_GPCR domain shown below is 4.9e-46.

EYSKTFKGKYFNFLGYFFSIYCVWKIFMATINIVLDRVGKTDPVTRGIEITVNYLGIQFD
VKFWSQHISFILVGIIIVTSIRGLLITLTKFFYAISSSKSSNVIVLLLAQIMGMYFVSSV
LLIRMSMPPEYRTIITEVLGELQFNFYHRWFDVIFLVSALSSILFLYLAHK

ABA_GPCR

ABA_GPCR
PFAM accession number:PF12430
Interpro abstract (IPR025969):

This domain is found in eukaryotes, and is typically between 177 and 216 amino acids in length. It is found in the abscisic acid (ABA) G-protein coupled receptor [(PUBMED:19135895)]. ABA is a stress hormone in plants. It is also found proteins identified as Golgi pH regulators [(PUBMED:18794847)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ABA_GPCR