The domain within your query sequence starts at position 136 and ends at position 252; the E-value for the ABC1 domain shown below is 2.2e-42.
EDLGKEIHDLFLSFDDTPLGAASLAQVHKAVLHDGRTVAVKVQHPKVQAQSSKDILLMEV LVLAVKQLFPDFEFMWLVDEAKKNLPLELDFLNEGRNAEKVAHMLRHFDFLKVPQIH
ABC1 |
![]() |
---|
PFAM accession number: | PF03109 |
---|---|
Interpro abstract (IPR004147): | This entry represents a domain found in Escherichia coli UbiB, known in Providencia stuartii as Aarf, which is required for ubiquinone (CoQ) biosynthesis [(PUBMED:10960098), (PUBMED:9422602), (PUBMED:23709220)]. Some proteins with this domain are described as aarF domain-containing protein kinases (ADCKs). This domain is also found in yeast ABC1 proteins (P27697) required for function of the mitochondrial bc1 complex [(PUBMED:1648478)], in which CoQ functions as an essential cofactor. The function of these proteins is not clear. Along with ABC1, UbiB is part of a large family of proteins that contain motifs found in eukaryotic-type protein kinases [(PUBMED:9799791)], but is not known if they have kinase activity and how this would relate to their requirement for the monoxygenase step in CoQ synthesis. A role in regulation of this step by phosphorylation has been speculated [(PUBMED:10960098)]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ABC1