The domain within your query sequence starts at position 12 and ends at position 148; the E-value for the ABC_trans_CmpB domain shown below is 8.5e-14.
RWYLYAIHGYFCEVMFTAAWEFVVNFNWKFPGVTSVWALFIYGTSILIVEHMYLRLRGRC PLLVRCVIYTLWTYLWEFTTGFILRQFTACPWDYSQFDFDFMGLITLEYAVPWFCGALIM EQFIIRNTLRLRFDKDA
ABC_trans_CmpB |
---|
PFAM accession number: | PF06541 |
---|---|
Interpro abstract (IPR010540): | This entry includes a group of transmembrane proteins, including CmpB from bacteria and TMEM229 from animals. CmpB is a family of membrane proteins that are likely to be part of a two-component type IV ABC-transporter system. Families can transport multiple drugs including ethidium and fluoroquinolones. UniProtKB:Q83XH0 ( Q83XH0 ) is a member of TCDB family [ (PUBMED:18504552) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ABC_trans_CmpB