The domain within your query sequence starts at position 1 and ends at position 116; the E-value for the ABC_transp_aux domain shown below is 1.8e-13.
MEKELRSTILFNAYKKEVFTTNTGYKSLQKRLRSNWKIQSLKDEITSEKLIGVKLWITAG PREKFTAAEFEVLKKYLDSGGDILVMLGEGGESRFDTNINFLLEEYGIMVNNDAVV
ABC_transp_aux |
---|
PFAM accession number: | PF09822 |
---|---|
Interpro abstract (IPR019196): | This domain is found in various eukaryotic and prokaryotic intra-flagellar transport proteins involved in gliding motility, as well as in several hypothetical proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ABC_transp_aux