The domain within your query sequence starts at position 251 and ends at position 326; the E-value for the ABM domain shown below is 2.4e-13.

IMLVQRQMSVTEEDLEEFQLALKHYVESASAQSGCLRISIQKLSNESRYMIYEFWENSSV
WNRHLQTNYSKTFQRS

ABM

ABM
PFAM accession number:PF03992
Interpro abstract (IPR007138):

The antibiotic biosynthesis monooxygenase (ABM) domain is found in proteins involved in a diverse range of biological processes, including metabolism, transcription, translation and biosynthesis of secondary metabolites:

  • Streptomyces coelicolor ActVA-Orf6 monooxygenase, plays a role in the biosynthesis of aromatic polyketides, specifically the antibiotic actinorhodin, by oxidizing phenolic groups to quinones [(PUBMED:12514126)].
  • Escherichia coli probable quinol monooxygenase YgiN, can oxidize menadiol to menadione [(PUBMED:15613473)].
  • Staphylococcus aureus heme-degrading enzymes IsdG and IsdI [(PUBMED:15520015), (PUBMED:18713745)].
  • Staphylococci signal transduction protein TRAP (target of RNAIII- activating protein) [(PUBMED:22750855)].
  • Mycobacterium tuberculosis heme-degrading monooxygenase MhuD (or Rv3592) [(PUBMED:19917297)].
  • Mycobacterium tuberculosis putative monooxygenase Rv0793, might be involved in antibiotic biosynthesis, or may act as reactive oxygen species scavenger that could help in evading host defenses [(PUBMED:16496224)].
  • Thermus thermophilus hypothetical protein TT1380 [(PUBMED:15103643)].

The ABM domain has only moderate sequence homology while sharing a high degree of structural similarity. The ABM domain crystallizes as a homodimer. Each monomer is composed of three alpha-helices (H1-3) and four beta-strands (S1-4) and has a ferredoxin-like split BetaAlphaBeta-fold with an antiparallel beta- sheet [(PUBMED:15103643)]. The beta-sheets of two monomers form a 10-strand, anti- parallel beta-barrel. The barrel is built of two smaller sheets that are connected by long C-terminal strands crossing over from one monomer to the other providing important interactions within the dimer. The core of the barrel is mainly hydrophobic [(PUBMED:12514126), (PUBMED:15613473), (PUBMED:15520015), (PUBMED:22750855), (PUBMED:16496224), (PUBMED:15103643)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ABM