The domain within your query sequence starts at position 51 and ends at position 107; the E-value for the ACAS_N domain shown below is 8.6e-17.

YPALSAQAAQEPAAFWGPLARDTLVWDTPYHTVWDCDFRTGKIGWFLGGQLNVSVNC

ACAS_N

ACAS_N
PFAM accession number:PF16177
Interpro abstract (IPR032387):

This domain is found at the N terminus of many acetyl-coenzyme A synthetase enzymes. The function of this domain is not clear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ACAS_N