The domain within your query sequence starts at position 38 and ends at position 118; the E-value for the ACBP domain shown below is 3e-32.
QQDFENALNQVKLLKKDPGNEVKLRLYALYKQATEGPCNMPKPGMLDFVNKAKWDAWNAL GSLPKETARQNYVDLVSSLSS
ACBP |
![]() |
---|
PFAM accession number: | PF00887 |
---|---|
Interpro abstract (IPR000582): | Acyl-CoA-binding protein (ACBP) is a small (10 Kd) protein that binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters [ (PUBMED:1454809) ]. ACBP is also known as diazepam binding inhibitor (DBI) or endozepine (EP) because of its ability to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor [ (PUBMED:1649940) ]. ACBP is a highly conserved protein of about 90 residues that is found in all four eukaryotic kingdoms, Animalia, Plantae, Fungi and Protista, and in some eubacterial species [ (PUBMED:16018771) ]. Although ACBP occurs as a completely independent protein, intact ACB domains have been identified in a number of large, multifunctional proteins in a variety of eukaryotic species. These include large membrane-associated proteins with N-terminal ACB domains, multifunctional enzymes with both ACB and peroxisomal enoyl-CoA Delta(3), Delta(2)-enoyl-CoA isomerase domains, and proteins with both an ACB domain and ankyrin repeats ( IPR002110 ) [ (PUBMED:16018771) ]. The ACB domain consists of four alpha-helices arranged in a bowl shape with a highly exposed acyl-CoA-binding site. The ligand is bound through specific interactions with residues on the protein, most notably several conserved positive charges that interact with the phosphate group on the adenosine-3'phosphate moiety, and the acyl chain is sandwiched between the hydrophobic surfaces of CoA and the protein [ (PUBMED:11491287) ]. Other proteins containing an ACB domain include:
|
GO function: | fatty-acyl-CoA binding (GO:0000062) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ACBP