The domain within your query sequence starts at position 818 and ends at position 1568; the E-value for the ACC_central domain shown below is 3.5e-253.

QLDNPSKVQQAELHTGSLPQIQSTALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSRV
KDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPLNVEKSIKKEMAQYASNITSVLCQFPS
QQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVE
TQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDE
LLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIE
NLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVV
EFQFMLPTSHPNRGNIPTLNRMSFASNLNHYGMTHVASVSDVLLDNAFTPPCQRMGGMVS
FRTFEDFVRIFDEIMGCFCDSPPQSPTFPESGHTSLYDEDKVPRDEPIHILNVAIKTDGD
IEDDRLAAMFREFTQQNKATLVEHGIRRLTFLVAQKDFRKQVNCEVDQRFHREFPKFFTF
RARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTD
YRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTNVRTDCNHIFLNFV
PTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTTTGKAIPIRLFLTNESGY
YLDISLYKEVTDSRTAQIMFQAYGDKQGPLH

ACC_central

ACC_central
PFAM accession number:PF08326
Interpro abstract (IPR013537):

This region is found in various eukaryotic acetyl-CoA carboxylases, N-terminal to the catalytic domain. Enzymes containing this domain (EC 6.4.1.2) are involved in the synthesis of long-chain fatty acids, as they catalyses the rate limiting step in this process.

GO process:fatty acid biosynthetic process (GO:0006633)
GO function:ATP binding (GO:0005524), acetyl-CoA carboxylase activity (GO:0003989)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ACC_central