The domain within your query sequence starts at position 329 and ends at position 420; the E-value for the ACP_syn_III_C domain shown below is 1.8e-7.

LQKAGLTVNDIDIFEINEAFASQAVYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVV
TLLNELKRRGRRAYGVVSMCIGTGMGAAAVFE

ACP_syn_III_C

ACP_syn_III_C
PFAM accession number:PF08541
Interpro abstract (IPR013747):

This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III EC 2.3.1.41, the enzyme responsible for initiating the chain of reactions of the fatty acid synthase in plants and bacteria [(PUBMED:10600651)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ACP_syn_III_C