The domain within your query sequence starts at position 6 and ends at position 70; the E-value for the ACTL7A_N domain shown below is 1.3e-39.

VWAPQTANIGDGPAKKASDQASMQTQVLQTASLKDGPAKRAVWVRRDNAETEDPVKSTMS
KDRPR

ACTL7A_N

ACTL7A_N
PFAM accession number:PF16840
Interpro abstract (IPR031769):

This entry represents the N terminus of actin-like protein 7A. This domain interacts and forms a heterodimer with TES, a putative human tumor suppressor. This heterodimer then interacts with ENAH to form a heterotrimer [(PUBMED:21278383)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ACTL7A_N