The domain within your query sequence starts at position 71 and ends at position 141; the E-value for the ACT_7 domain shown below is 9.4e-22.

VADATWLALNVVSGGGSFSSSQPIGVTKIAKSVIAPLADQNISVFMLSTYQTDFILVRER
DLPFVTHTLSS

ACT_7

ACT_7
PFAM accession number:PF13840
Interpro abstract (IPR027795):

The ACT domain is a structural motif of 70-90 amino acids that functions in the control of metabolism, solute transport and signal transduction. They are thus found in a variety of different proteins in a variety of different arrangements [(PUBMED:16987805)]. In mammalian phenylalanine hydroxylase the domain forms no contacts but promotes an allosteric effect despite the apparent lack of ligand binding [(PUBMED:18368466)].

This ACT domain is found in CASTOR proteins IPR026249 and C-terminal in some aspartate kinases.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ACT_7