The domain within your query sequence starts at position 718 and ends at position 836; the E-value for the ADAM_spacer1 domain shown below is 2.6e-34.

QTLAGVFNSAHYGYNVVVKIPAGATNIEILQHSYSGRPEDDNYLALSDTQGNFLLNGNFV
VSMAKKEINIQGAVFEYSGSNNSIERINSTDRLEAELVLQVLCVGNLYNPDVRYSFNIP

ADAM_spacer1

ADAM_spacer1
PFAM accession number:PF05986
Interpro abstract (IPR010294):

This domain represents the Spacer-1 domain from the ADAM-TS family of metalloproteinases [(PUBMED:11279086)].

A cellular disintegrin and metalloproteinase (ADAM) is a family of genes with structural homology to the snake venom metalloproteinases and disintegrins [(PUBMED:8995297)]. There is variation amongst members of the family, however, all have a similar domain organisation comprising a preproregion, a reprolysin-type catalytic domain, a disintegrin-like domain, a thrombospondin type-1 (TS) module, a cysteine-rich domain, a spacer domain without cysteine residues, and a COOH-terminal TS module [(PUBMED:10464288), (PUBMED:11279086)]. They are involved in embryogenesis and have been implicated in some cancers and inflammatory diseases [(PUBMED:11279086)].

GO component:extracellular matrix (GO:0031012)
GO function:metalloendopeptidase activity (GO:0004222)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ADAM_spacer1