The domain within your query sequence starts at position 70 and ends at position 140; the E-value for the ADH_N domain shown below is 7.7e-11.

GSDVHVRMLAAPINPSDINMIQGNYGLLPKLPAVGGNEGVGQVIAVGSSVSALKPGDWVI
PANAGLGTWRT

ADH_N

ADH_N
PFAM accession number:PF08240
Interpro abstract (IPR013154):

This is the catalytic domain of alcohol dehydrogenases (EC 1.1.1.1). Many of them contain an inserted zinc binding domain. This domain has a GroES-like structure; a name derived from the superfamily of proteins with a GroES fold. Proteins with a GroES fold structure have a highly conserved hydrophobic core and a glycyl-aspartate dipeptide which is thought to maintain the fold [(PUBMED:10556240), (PUBMED:8804825)].

GO process:oxidation-reduction process (GO:0055114)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ADH_N