The domain within your query sequence starts at position 4 and ends at position 56; the E-value for the ADH_N_2 domain shown below is 1.3e-12.
QRVVLNSRPGKNGNPVAENFRVEEFSLPDALNEGQVQVRTLYLSVDPYMLLTT
ADH_N_2 |
---|
PFAM accession number: | PF16884 |
---|---|
Interpro abstract (IPR041694): | This is the N-terminal domain of prostaglandin reductase and other oxidoreductases. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ADH_N_2