The domain within your query sequence starts at position 4 and ends at position 56; the E-value for the ADH_N_2 domain shown below is 1.3e-12.

QRVVLNSRPGKNGNPVAENFRVEEFSLPDALNEGQVQVRTLYLSVDPYMLLTT

ADH_N_2

• PFAM accession number: PF16884
• Interpro abstract (IPR041694):

  This is the N-terminal domain of prostaglandin reductase and other oxidoreductases.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ADH_N_2