The domain within your query sequence starts at position 5 and ends at position 152; the E-value for the ADH_N_2 domain shown below is 7.5e-63.
KSWTLKKHFEGFPTDGNFELKTTELPPLNNGEVLLEALFLSVDPYMRVAAKKLKEGDRMM GEQVARVVESKNSAFPKGTIVAALLGWTSHSISDGNGLTKLPVEWPDKLPLSLALGTVGM PGLTAYFGLLDICGVKGGETVMVSAAAG
ADH_N_2 |
---|
PFAM accession number: | PF16884 |
---|---|
Interpro abstract (IPR041694): | This is the N-terminal domain of prostaglandin reductase and other oxidoreductases. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ADH_N_2