The domain within your query sequence starts at position 209 and ends at position 325; the E-value for the AHSA1 domain shown below is 1.4e-23.
DTTVEQLYSIFTVKELVQKFSKSPAVLEAERGGKFQMFDGNISGEYVELVTNRKIIMKWR CRNWPEEHYATVELNFVPAPGQTELQLDCKGVPVCKEENMKFCWQKQHFEEIKGLLE
AHSA1 |
![]() |
---|
PFAM accession number: | PF08327 |
---|---|
Interpro abstract (IPR013538): | This family includes eukaryotic, prokaryotic and archaeal proteins that bear similarity to a C-terminal region of human activator of 90 kDa heat shock protein ATPase homologue 1 (AHSA1/p38, O95433). This protein is known to interact with the middle domain of Hsp90, and stimulate its ATPase activity [(PUBMED:12604615)]. It is probably a general up regulator of Hsp90 function, particularly contributing to its efficiency in conditions of increased stress [(PUBMED:12504007)]. p38 is also known to interact with the cytoplasmic domain of the VSV G protein, and may thus be involved in protein transport [(PUBMED:11554768)]. It has also been reported as being under expressed in Down's syndrome. This region is found repeated in two members of this family (Q8XY04 and Q6MH87). |
GO process: | response to stress (GO:0006950) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AHSA1