The domain within your query sequence starts at position 1 and ends at position 117; the E-value for the AIF-MLS domain shown below is 2.1e-19.

MFRCGGLAGAFKQKLVPLVRTVYVQRPKQRNRLPVVQCHLLGSPSRTLASAGASGKDGSS
LVYFLIVGATVTGAGIYYAYKTIKEDQKRYNERVMGLGLSPEEKQRRAIASATEGGS

AIF-MLS

AIF-MLS
PFAM accession number:PF14962
Interpro abstract (IPR032773):

This entry represents the N-terminal domain of the protein MGARP (also known as HUMMR) [ (PUBMED:19528298) ]. HUMMR interacts with Miro, an mitochondrial membrane protein. It biases mitochondrial movement in the anterograde direction in response to hypoxia [ (PUBMED:20016276) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AIF-MLS