The domain within your query sequence starts at position 10 and ends at position 177; the E-value for the AIF-MLS domain shown below is 7.6e-54.
LGSSLEFLISASLRRMSSRKFPGTSGSNMIYYLVVGVTVSAGGYYTYKALTSKQVRRTEH VAEPKEQTKAELQPLPGEKEEHVAEAEQVCSEPGDTAVTEAESVDAEEVPEAAVVLPEES QASAPSEVPAEAAVVEASLSSSEPELKITEASLVETTESVPESTQEVE
AIF-MLS |
---|
PFAM accession number: | PF14962 |
---|---|
Interpro abstract (IPR032773): | This entry represents the N-terminal domain of the protein MGARP (also known as HUMMR) [ (PUBMED:19528298) ]. HUMMR interacts with Miro, an mitochondrial membrane protein. It biases mitochondrial movement in the anterograde direction in response to hypoxia [ (PUBMED:20016276) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AIF-MLS