The domain within your query sequence starts at position 192 and ends at position 368; the E-value for the AIRS_C domain shown below is 3.6e-32.
VPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEAMMNMARLNRTA AGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFG LMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIID
AIRS_C |
![]() |
---|
PFAM accession number: | PF02769 |
---|---|
Interpro abstract (IPR010918): | This domain is found in carbamoyl dehydratase HypE, which is involved in the maturation of NifE hydrogenase; AIR synthase (PurM) and FGAM synthase (PurL), which are involved in de novo purine biosynthesis; and selenide, water dikinase, an enzyme which synthesizes selenophosphate from selenide and ATP. In PurM this domain, which has an alpha-beta-type fold, is found at the C terminus of the protein [ (PUBMED:10508786) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AIRS_C