The domain within your query sequence starts at position 853 and ends at position 988; the E-value for the AIRS_C domain shown below is 3e-11.

VPLSPGQHRLGGTALAQCFSQLGEHPPDLDLPENLVRAFHITQGLLKECRLCSGHDVSDG
GLVTCLLEMAFAGNCGIEVDVPAPGIHALPVLFAEEPGLVLEVQEADVAGVRQRYESAGL
RCLELGHTGEAGPQAM

AIRS_C

AIRS_C
PFAM accession number:PF02769
Interpro abstract (IPR010918):

This domain is found in carbamoyl dehydratase HypE, which is involved in the maturation of NifE hydrogenase; AIR synthase (PurM) and FGAM synthase (PurL), which are involved in de novo purine biosynthesis; and selenide, water dikinase, an enzyme which synthesizes selenophosphate from selenide and ATP.

In PurM this domain, which has an alpha-beta-type fold, is found at the C terminus of the protein [(PUBMED:10508786)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AIRS_C