The domain within your query sequence starts at position 100 and ends at position 165; the E-value for the AJAP1_PANP_C domain shown below is 5.3e-13.
IVWGPTVSREDGGDPNSVNPGFLPLDYGFAAPHGLATPHPNSDSMRDDGDGLILGETPAT LRPFLF
AJAP1_PANP_C |
---|
PFAM accession number: | PF15298 |
---|---|
Interpro abstract (IPR029198): | This is a domain found in the C terminus of adherens junction-associated protein 1 (AJAP1) and of PILR-associating neural protein (PANP). AJAP1 inhibits cell adhesion and migration [ (PUBMED:16410724) ]. PANP is a ligand for the immune inhibitory receptor paired immunoglobulin-like type 2 receptor alpha [ (PUBMED:21241660) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AJAP1_PANP_C