The domain within your query sequence starts at position 100 and ends at position 272; the E-value for the AJAP1_PANP_C domain shown below is 2.1e-61.

IVWGPTVSREDGGDPNSVNPGFLPLDYGFAAPHGLATPHPNSDSMRDDGDGLILGETPAT
LRPFLFGGRGEGVDPQLYVTITISIIIVLVATGIIFKFCWDRSQKRRRPSGQQGALRQEE
SQQPLTDLSPAGVTVLGAFGDSPTPTPDHEEPRGGPRPGMPQPKGAPAFQLNR

AJAP1_PANP_C

AJAP1_PANP_C
PFAM accession number:PF15298
Interpro abstract (IPR029198):

This is a domain found in the C terminus of adherens junction-associated protein 1 (AJAP1) and of PILR-associating neural protein (PANP). AJAP1 inhibits cell adhesion and migration [(PUBMED:16410724)]. PANP is a ligand for the immune inhibitory receptor paired immunoglobulin-like type 2 receptor alpha [(PUBMED:21241660)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AJAP1_PANP_C