The domain within your query sequence starts at position 408 and ends at position 528; the E-value for the AKAP28 domain shown below is 9.3e-50.
WLTHGEFTPEKGRKQIEKFVSTWEFQNRWVYYADFIEKKDLIHSYHYIYRVRWSAPTAVR PMARVSANALFTIKFNKSKPADMPVDVSYIFENSELLQRPGEIRFREQWLRDITETKHIL L
AKAP28 |
---|
PFAM accession number: | PF14469 |
---|---|
Interpro abstract (IPR025663): | 28kDa AKAP (AKAP28) is highly enriched in human airway axonemes. The mRNA for AKAP28 is up-regulated as primary airway cells differentiate and is specifically expressed in tissues containing cilia and/or flagella [ (PUBMED:12475942) ]. Homologs of AKAP28 are present in all animals. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AKAP28