The domain within your query sequence starts at position 37 and ends at position 80; the E-value for the AKAP2_C domain shown below is 2.7e-11.
LRVRPVLSRPGSGTPLPRALERARAGAKMQRDIEREAHRQAALA
AKAP2_C |
---|
PFAM accession number: | PF15304 |
---|---|
Interpro abstract (IPR029304): | This domain is found at the C terminus of A-kinase anchor protein 2 (AKAP2). It includes the site where the regulatory subunits (RII) of protein kinase AII binds [ (PUBMED:9497389) ]. Besides AKAP2, proteins containing this domain include mitotic interactor and substrate of PLK1 (Misp) [ (PUBMED:23574715) ] and uncharacterised protein LOC113230. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AKAP2_C