The domain within your query sequence starts at position 51 and ends at position 249; the E-value for the AKAP7_NLS domain shown below is 2.1e-52.

PNYFLSIPITNKKITTGIKVLQNSILQQDKRLTKAMVGDGSFHITLLVMQLLNEDEVNIG
TDALLELKPFVEEILEGKHLALPFQGIGTFQGQVGFVKLADGDHVSALLEIAETAKRTFR
EKGILAGESRTFKPHLTFMKLSKAPMLRKKGVRKIEPGLYEQFIDHRFGEELLYQIDLCS
MLKKKQSNGYYHCESSIVI

AKAP7_NLS

AKAP7_NLS
PFAM accession number:PF10469
Interpro abstract (IPR019510):

This entry represents the nuclear localisation signal-containing domain found in the cyclic AMP-dependent protein kinase A (PKA) anchor protein, AKAP7. This protein anchors PKA for its role in regulating PKA-mediated gene transcription in both somatic cells and oocytes [ (PUBMED:12804576) ]. This domain carries the nuclear localisation signal (NLS) KKRKK, that indicates the cellular destiny of this anchor protein [ (PUBMED:16483255) ].

The domain is also found in a number of other proteins, such as activating signal cointegrator 1 complex subunit 1 and leukocyte receptor cluster member 9.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AKAP7_NLS