The domain within your query sequence starts at position 255 and ends at position 312; the E-value for the AKAP7_RIRII_bdg domain shown below is 1.9e-35.

REPEDAELVRLSKRLVENAVLKAVQQYLEETQNKKQPGEGNSTKAEEGDRNGDGSDNN

AKAP7_RIRII_bdg

• PFAM accession number: PF10470
• Interpro abstract (IPR019511):

  This entry represents the RI-RII subunit-binding domain found at the C-terminal of the cyclic AMP-dependent protein kinase A (PKA) anchor protein, AKAP7. This protein anchors PKA, for its role in regulating PKA-mediated gene transcription in both somatic cells and oocytes, by binding to its regulatory subunits, RI and RII, hence being known as a dual-specific AKAP [ (PUBMED:12804576) ]. The 25 crucial amino acids of RII-binding domains in general form structurally conserved amphipathic helices with unrelated sequences; hydrophobic amino acid residues form the backbone of the interaction and hydrogen bond- and salt-bridge-forming amino acid residues increase the affinity of the interaction [ (PUBMED:16483255) ]. The nuclear localisation signal-containing domain is found at the N terminus.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AKAP7_RIRII_bdg