The domain within your query sequence starts at position 51 and ends at position 118; the E-value for the ALG3 domain shown below is 2.1e-17.
RGGHHLLGHSQGGIYPAGFLYIFTGLFYATDRGTDIPMAQNIFAVLYLVTLVLVFLIYHQ TSKPGCLG
ALG3 |
---|
PFAM accession number: | PF05208 |
---|---|
Interpro abstract (IPR007873): | The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man [ (PUBMED:11308030) ]. The ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase. |
GO function: | mannosyltransferase activity (GO:0000030) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ALG3