The domain within your query sequence starts at position 416 and ends at position 704; the E-value for the ALIX_LYPXL_bnd domain shown below is 1.4e-64.

HIPPQLMEKCAALSVRPDTVKNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELQEQKLQE
TLGQAGAGPGPSVAKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVGNLRLLSGPL
DQVRAALPTPALTPEDKAVLQNLKRILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTT
DHSEMKKLFEEQLKKYDQLKVYLEQNLAAQDNVLRALTEANVQYAAVRRVLSELDQKWNS
TLQTLVASYEAYEDLMKKSQEGKDFYADLESKVATLLERAQSICRAQEA

ALIX_LYPXL_bnd

ALIX_LYPXL_bnd
PFAM accession number:PF13949
Interpro abstract (IPR025304):

The binding of the LYPxL motif of late HIV p6Gag and EIAV p9Gag to this domain is necessary for viral budding. In ALIX, a component of the ESCRT pathway, this domain is central between an N-terminal Bro1 domain and a C-terminal proline-rich domain. The ALIX central domain is formed by two three-helix bundles disposed in a V shape [(PUBMED:17350572), (PUBMED:17277784)]. Retroviruses thus used this domain to hijack the ESCRT system of the cell [(PUBMED:18066081)].

GO function:protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ALIX_LYPXL_bnd