The domain within your query sequence starts at position 3125 and ends at position 3247; the E-value for the ALMS_motif domain shown below is 1.8e-42.

FVRATLQESLQLHRPDFISHSGERIKRLKLLVQERKLQSLFQSEREALFHSARPLPRRVL
LAVQKNKPIGKKEMIQRTRRIYEQLPEVKKKREEEKRKSEYKSYWLRAQHYKMKVTNHLL
GRK

ALMS_motif

ALMS_motif
PFAM accession number:PF15309
Interpro abstract (IPR029299):

This domain is found at the C terminus of Alstrom syndrome protein 1 (ALMS1), KIAA1731 and C10orf90 [(PUBMED:11941369), (PUBMED:20844083)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ALMS_motif