The domain within your query sequence starts at position 75 and ends at position 439; the E-value for the AMH_N domain shown below is 3e-133.

NSYEYAFLEAVQESRWGPQDLATFGVCSTDSQATLPALQRLGAWLGETGEQQLLVLHLAE
VIWEPELLLKFQEPPPGGASRWEQALLVLYPGPGPQVTVTGTGLRGTQNLCPTRDTRYLV
LTVDFPAGAWSGSGLILTLQPSREGATLSIDQLQAFLFGSDSRCFTRMTPTLVVLPPAEP
SPQPAHGQLDTMPFPQPGLSLEPEALPHSADPFLETLTRLVRALRGPLTQASNTQLALDP
GALASFPQGLVNLSDPAALGRLLDWEEPLLLLLSPAAATEREPMPLHGPASAPWAAGLQR
RVAVELQAAASELRDLPGLPPTAPPLLARLLALCPNDSRSSGDPLRALLLLKALQGLRAE
WHGRE

AMH_N

AMH_N
PFAM accession number:PF04709
Interpro abstract (IPR006799): Anti-Mullerian hormone, AMH is a signalling molecule involved in male and female sexual differentiation [(PUBMED:1782869)]. Defects in synthesis or action of AMH cause persistent Mullerian duct syndrome (PMDS), a rare form of male pseudohermaphroditism [(PUBMED:8162013)]. This family represents the N-terminal part of the protein, which is not thought to be essential for activity [(PUBMED:8162013)]. AMH contains a TGF-beta domain (IPR001839), at the C terminus.
GO process:gonad development (GO:0008406)
GO function:growth factor activity (GO:0008083)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AMH_N