The domain within your query sequence starts at position 109 and ends at position 584; the E-value for the AMP-binding domain shown below is 9.5e-26.

QRWGSTQAKCPCLTGLDVTGKPVYTLTYGKLWSRSLKLAYTLLNKLGTKNEPVLKPGDRV
ALVYPNNDPVMFMVAFYGCLLAEVIPVPIEVPLTRKDAGGQQIGFLLGSCGIALALTSEI
CLKGLPKTQNGEIVQFKGWPRLKWVVTDSKYLSKPPKDWQPHISPAGTEPAYIEYKTSKE
GSVMGVTVSRLAMLSQCQALSQACNYSEGETVVNVLDFKKDAGLWHGMFANVMNKMHTIS
VPYSVMKTCPLSWVQRVHAHKAKVALVKCRDLHWAMMAHRDQRDVSLSSLRMLIVTDGAN
PWSVSSCDAFLSLFQSHGLKPEAICPCATSAEAMTVAIRRPGVPGAPLPGRAILSMNGLS
YGVIRVNTEDKNSALTVQDVGHVMPGGMMCIVKPDGLPQLCRTDEIGEICVSSRTGGMMY
FGLAGVTKNTFEVIPVTSSGSPVGDVPFIRSGLLGFVGPGSLVFVVGKMDGLLMVS

AMP-binding

AMP-binding
PFAM accession number:PF00501
Interpro abstract (IPR000873):

A number of prokaryotic and eukaryotic enzymes, which appear to act via an ATP-dependent covalent binding of AMP to their substrate, share a region of sequence similarity [(PUBMED:2118102), (PUBMED:2911486), (PUBMED:2254270)]. This region is a Ser/Thr/Gly-rich domain that is further characterised by a conserved Pro-Lys-Gly triplet. The family of enzymes includes luciferase, long chain fatty acid Co-A ligase, acetyl-CoA synthetase and various other closely-related synthetases.

GO process:metabolic process (GO:0008152)
GO function:catalytic activity (GO:0003824)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AMP-binding