The domain within your query sequence starts at position 523 and ends at position 598; the E-value for the AMP-binding_C domain shown below is 2.9e-9.

EVEAVLSRLLGQTDVAVYGVAVPGVEGKAGMAAIADPHSQLDPNSMYQELQKVLASYARP
IFLRLLPQVDTTGTFK

AMP-binding_C

AMP-binding_C
PFAM accession number:PF13193
Interpro abstract (IPR025110):

This is a small domain that is found C-terminal to IPR000873. It has a central beta sheet core that is flanked by alpha helices.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AMP-binding_C