The domain within your query sequence starts at position 76 and ends at position 160; the E-value for the AMPK1_CBM domain shown below is 1.1e-38.
RPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHD PSEPVVTSQLGTINNLIHVKKSDFE
AMPK1_CBM |
---|
PFAM accession number: | PF16561 |
---|---|
Interpro abstract (IPR032640): | This domain can be found in AMP-activated protein kinases and CRP1/MDG1 family members. The surface of this domain reveals a carbohydrate-binding pocket [ (PUBMED:16216577) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AMPK1_CBM